PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1671s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 260aa    MW: 29377 Da    PI: 5.9765
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1671s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM148.82.8e-46181501128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgy 82 
                             lp GfrF Pt+eel+++yL++k+eg++ e  +  i+++ iy++ePwdLpk     +++++++w+fF++r++++a+g r+nr+t+sgy
  SapurV1A.1671s0050.1.p  18 LPLGFRFYPTEEELISFYLHNKLEGERQERMQLvIPDISIYDIEPWDLPKlsgqLCQGDTEQWFFFAPRQEREARGGRPNRTTASGY 104
                             699***********************97665655***************656754455777************************** PP

                     NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             Wkatg+  +v+s++++++glkkt+vfy+g+ap+g+kt+W m+eyr+
  SapurV1A.1671s0050.1.p 105 WKATGSPGHVYSSDNRVIGLKKTMVFYTGKAPSGRKTKWKMNEYRA 150
                             ********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-4914174IPR003441NAC domain
PROSITE profilePS5100549.01618176IPR003441NAC domain
PfamPF023654.8E-2419149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MLIQLRLSSE LDKKMEELPL GFRFYPTEEE LISFYLHNKL EGERQERMQL VIPDISIYDI  60
EPWDLPKLSG QLCQGDTEQW FFFAPRQERE ARGGRPNRTT ASGYWKATGS PGHVYSSDNR  120
VIGLKKTMVF YTGKAPSGRK TKWKMNEYRA IEVHELSNNA TPQLRHEFSL CRVYVISGSF  180
RAFDRRPQEA VSRETQLLGG AATSSVHGPP PLDMTSSPET SYSVEDHVDN PGPAESASWG  240
TVVGLAPPAW DWPGQLDWP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-351817417163NO APICAL MERISTEM PROTEIN
1ut4_B2e-351817417163NO APICAL MERISTEM PROTEIN
1ut7_A2e-351817417163NO APICAL MERISTEM PROTEIN
1ut7_B2e-351817417163NO APICAL MERISTEM PROTEIN
3swm_A2e-351817420166NAC domain-containing protein 19
3swm_B2e-351817420166NAC domain-containing protein 19
3swm_C2e-351817420166NAC domain-containing protein 19
3swm_D2e-351817420166NAC domain-containing protein 19
3swp_A2e-351817420166NAC domain-containing protein 19
3swp_B2e-351817420166NAC domain-containing protein 19
3swp_C2e-351817420166NAC domain-containing protein 19
3swp_D2e-351817420166NAC domain-containing protein 19
4dul_A2e-351817417163NAC domain-containing protein 19
4dul_B2e-351817417163NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298277.21e-164NAC domain-containing protein 90
SwissprotQ9FMR35e-94NAC90_ARATH; NAC domain-containing protein 90
TrEMBLB9GI041e-164B9GI04_POPTR; NAC domain-containing protein 90
STRINGPOPTR_0001s22630.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.13e-95NAC domain containing protein 90